PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10004409m
Common NameEUTSA_v10004409mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family M-type_MADS
Protein Properties Length: 378aa    MW: 42910.1 Da    PI: 7.0862
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10004409mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF63.72e-201053245
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                     + en+  rq tf+kR+ngilKKA+ELS+LCd+++ +++f++tgk
  Thhalv10004409m 10 KLENTQGRQSTFAKRKNGILKKANELSILCDIDIVLLMFAPTGK 53
                     679***************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.3E-29160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006624.025153IPR002100Transcription factor, MADS-box
CDDcd002662.44E-24282No hitNo description
SuperFamilySSF554556.28E-25294IPR002100Transcription factor, MADS-box
PRINTSPR004048.6E-17323IPR002100Transcription factor, MADS-box
PfamPF003196.5E-181154IPR002100Transcription factor, MADS-box
PRINTSPR004048.6E-172338IPR002100Transcription factor, MADS-box
PRINTSPR004048.6E-173859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
MGRVKLKIKK LENTQGRQST FAKRKNGILK KANELSILCD IDIVLLMFAP TGKPALCCGR  60
RSSMEEVIAK FSQVPPQERT KRKFESLENL KKTFQKLDHD VNIREFIASS NSTTEDLSTQ  120
VRILQARISE IHGRLSCWTE PEKINNVEHL GQLEMSIRQS LDQLRAHKEH FGQQQHAMQI  180
ENANFVKDWS TCSMQDGIQI PLEQQLQSMS WVLNSNNTNI VTEEQHSIPQ REVECSASSS  240
FGSYPGYFGT GKSPEITISG QETSFLDEFT TSNGHLKPQT NSQQQQQFIN SNNITYNPNL  300
QNDLNHHQTL PPPPVYNFPM NQREYHMNGF FEAPPPPGSS TYNNNINQTR FGSSSSSLPC  360
SVSMFEEYLF SQMQQPN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ4464590.0DQ446459.1 Arabidopsis thaliana clone pENTR221-At2g03060 MADS-box family protein (At2g03060) mRNA, complete cds.
GenBankDQ6529540.0DQ652954.1 Arabidopsis thaliana clone 0000017365_0000012150 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006395741.10.0hypothetical protein EUTSA_v10004409mg
SwissprotQ1PFA40.0AGL30_ARATH; Agamous-like MADS-box protein AGL30
TrEMBLV4KSR20.0V4KSR2_EUTSA; Uncharacterized protein
STRINGAl_scaffold_0005_2280.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM87542539
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03060.20.0AGAMOUS-like 30